<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL5093 62410 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT NA
2 NVP+ DDI+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   G190A   V35T, K43R, E44ED, V60I, A98S, K122E, D123S, I135X, K173R, Q174E, D177E, I178M, T200A, Q207E, R211K, V245Q, E248D, D250E, A272P, T286A, V292I, I293V, E297A  
>62410| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELERDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSXNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRENPEMVI
YQYMDDLYVASDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, Q18R, K20I, E35D, M36I, R41K, H69K, K70R, V82I, L89M  
>62410| codons 1-99
PQITLWQRPLVTVRVGGRLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005