<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL30943 62042 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 21
2 D4T+3TC+IDV 187
3 D4T+NVP+RTV 57

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R   K103N   V35T, E40D, K43R, V60I, T69N, A98S, K122E, D123S, I135T, K173X, Q174K, D177E, T200AE, Q207K, R211S, F214FL, V245Q, E248N, D250E, A272P, T286A, E291D, V292VI, I293V, E297AV, L301M  
>62042| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDLEREGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRXKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005