<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL19374 62204 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ D4T NA
2 3TC+ D4T+ NFV+ NVP NA
3 Unknown 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K103N   V35T, A98S, I135M, S162CY, K173M, Q174K, T200A, E203G, Q207E, R211K, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A  
>62204| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRMKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIGELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005