<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL37131 61948 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 8
2 AZT+3TC+IDV 139
3 D4T+3TC+NVP 38

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV   Y181C   V35T, E40D, K43R, T69TN, A98S, K122E, D123S, K173I, Q174K, D177DE, T200A, Q207K, R211S, H221Y, V245Q, D250E, A272P, K277NS, T286A, A288T, I293V, E297A  
>61948| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEREGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVNQLCKLLRGAKTLTEVVPLTAEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005