<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
10BR_RJ019 10BR_RJ019 Brazil 2010 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, I72V, L101I, S119P, T206S, K211Q, I220L, Y227F, I268L, D270N  
>10BR_RJ019| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTQELQKQITKLQNFRVYFRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKILRNYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, I72E, V77I, I93L  
>10BR_RJ019| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAEGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135T, K166R, Q174H, R211K, A272T, K275Q, V276I, T286A, I293V, P294T, Q334H, P345Q, F346Y, R356K, A376V, K390R, T403A, A408T, K431T, S468P  
>10BR_RJ019| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKHNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYTGIQIKQLCKLLRGAKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHGQWTYQIYQEQYKNLKTGKYAKMRGA
HTNDVKQLTEAVQKIVTESIVIWGKTPKFRLPIQKETWEAWWAEYWQTTWIPEWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Pessoa, R Ultra-deep sequencing of HIV-1 near full-length and partial proviral genomes reveals high genetic diversity among Brazilian blood donors. PLoS One, 2016