<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
10BR_RJ040 10BR_RJ040 Brazil 2010 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    D6T, K7E, S17N, V31I, L74I, T112I, S119P, T124A, T125A, V201I, T206S, I220L, Q221T, L234I, A265V, R269K, D270H S283G
>10BR_RJ040| codons 1-288
FLDGITEAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKIIHTDNGPN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKLTNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIKHYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, N37D, R41K, I62V, L63P, V77I, I93L  
>10BR_RJ040| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, V35T, K102Q, K104R, K122E, I142V, D177E, I178M, Q207E, A272P, K277R, E297K, P313S, G333E, Q334L, R358K, A360T, A376V, T386I, K390R, A400T, T403M, R463K, L491V, L517I  
>10BR_RJ040| codons 1-560
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKRSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKESVHGVYYDPSKDLIAEIQKQELGQWTYQIYQEPFKNLKTGKYARMKGT
HTNDVKQLTEAVQKIVTESIVIWGKIPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGKQKVVSLTDTTNQKTELQ
AIHLALQDSGVEVNIVTDSQYALGIIQAQPDKSESEIVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Pessoa, R Ultra-deep sequencing of HIV-1 near full-length and partial proviral genomes reveals high genetic diversity among Brazilian blood donors. PLoS One, 2016