<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL9029 61126 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ ABC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215TS K103N V179E P4L, V35T, V60I, A98S, K122E, D123S, I135K, K173M, Q174K, D177E, T200A, Q207K, R211S, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, E312D  
>61126| codons 1-314
PISLIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSKNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMKNPEIEI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKDPV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36I, R41K, H69K, V82I, L89M L10L*Q
>61126| codons 1-99
PQITLWQRPQVTVRIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005