<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8487 59877 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT NA
2 SQV+ 3TC+ AZT NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M F53L L10LI, I13V, K14R, K20I, E35D, M36I, R41K, M46X, I62IV, L63LP, H69K, A71X, T74S, V82I, L89X  
>59877| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKXIGGIGGLIKVRQYD
QVPIEICGKKXIGSVLVGPTPINIIGRNXMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E     V35T, K43R, V60I, T69N, A98S, K122E, D123S, I135X, K173R, Q174K, D177E, T200A, Q207K, R211S, F214L, V245Q, E248D, D250E, A272P, K277KR, T286A, E291D, V292I, I293V, E297A Y127CS, T128A, F130Y
>59877| codons 1-321
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKCAAYTIPSXNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005