<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34668 56513 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ DDI+ RTV+ D4T NA
2 NVP+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39X, V60I, A98S, K122E, D123S, I135T, S162A, Q174E, D177E, T200A, Q207K, R211S, V245Q, D250E, A272P, K277R, T286A, E291D, V292I, I293V, E297A, P321PS, D324E  
>56513| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICXEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKENPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDSSKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15IV, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>56513| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005