<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35608 58508 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ DDC+ D4T+ AZT NA
2 NFV+ ABC+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   I13V, K14KR, I15V, L19V, K20I, E35D, M36I, I64M, H69K, L89M  
>58508| codons 1-99
PQITLWQRPLVTVRVGGQVIEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFVKVRQYD
QILMEICGKKAIGTVLVGPTPANIIGRNMMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219E     V21I, V35T, T39A, E53ED, V60I, K122E, D123N, I135V, S162A, K173T, Q174K, D177E, I178M, T200E, E203K, Q207E, V245Q, E248D, T286A, V292I, I293V, E297A  
>58508| codons 1-307
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICAEMEKEGKISKIGPDNPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIGQHREKIKELREHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENR

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005