<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35484 58235 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT NA
2 NFV+ 3TC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y K219Q     K20KR, V35L, K43R, V60I, A98S, D123DE, I135V, I142V, S162X, K173R, Q174K, D177E, G196E, T200A, Q207K, H208Y, R211N, D218E, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297T  
>58235| codons 1-323
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEREGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQXSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELRKYLLNWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML   T12A, I13V, K14R, K20T, E35D, M36I, R41K, I62V, L63P, H69K, A71T, T74S, V82I, L89X, I93M  
>58235| codons 1-99
PQITLWQRPLVAVRIGGQLTEALLDTGADDTVLEDINLPGKWKPKLIGGIGGFIKVRQYD
QVPIEICGKKTIGSVLVGPTPINIIGRNXLTQMGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005