<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL16925 58358 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75T, L210W, T215Y K219KN Y181C   V35KT, T39A, V60VI, S68G, V118VI, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, K223Q, P243S, V245E, T286A, E291D, V292I, I293V, P294T, S322A  
>58358| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
CQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWT
VQSIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L89V L10V, I13V, K20V, M36I, R41K, L63P, H69K, K70R  
>58358| codons 1-99
PQITLWQRPVVTVKIGGQLVEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNVMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005