<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35514 58316 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+3TC 60

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V V75A     V35T, K43R, V60I, K122E, D123S, Q174E, D177E, T200A, Q207K, R211S, H221HY, V245Q, E248N, D250E, A272P, T286A, E291D, V292I, I293V, E297T, A304E, D320E, D324E K73Q
>58316| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSTKWRQVADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LELEENREILKEPVHGVYYEPSKE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005