<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL871 58009 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 78
2 AZT+3TC+IDV 95
3 AZT+3TC+IDV+RTV 21

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V179E K20R, V35T, K43R, V60VI, T69S, A98S, K122E, D123S, I135V, E138A, T139A, I142IT, T165I, K173T, Q174K, D177E, I195K, T200A, R211S, F214L, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A K13KN, S134T
>58009| codons 1-311
PISPIETVPVKLNPGMDGPRVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPI
FAIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPTVNNAAPGTRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIEI
YQYVDDLYVGSDLEKGQHRAKIEELRQHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILK

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005