<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL26067 57678 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NVP 43
2 D4T+DDI+NVP 43

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R D67G, K219KQ     K20R, V35T, K43R, K49R, V60I, T69N, A98S, K104T, K122E, D123T, I135T, Q174K, D177E, I178L, Q207A, R211K, F214L, V245T, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D320E, D324E  
>57678| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEREGKISRIGPENPYNTPI
FAIKKKGSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKTSVTVLDVGDAYFSVPL
DETFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLKWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYYEPSKE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005