<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35102 57431 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 74
2 D4T+DDI+SQV 47
3 D4T+3TC+NVP+NFV 130
4 D4T+3TC+EFV+IDV 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M A62AV, V75I, F77L, F116Y Y181C, G190A F227L V21I, V35T, E40D, K43KR, T58N, S68G, V90I, A98S, T139TA, R172K, K173T, Q174K, D177E, I195K, G196E, T200A, R211S, F214L, H221Y, E224D, V245Q, E248D, D250E, A272P, T286A, A288AT, E291D, V292I, I293V, E297A  
>57431| codons 1-309
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICTDMEREGKISKIGPENPYNNPV
FVIKRKDGTRWRKLIDLRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNEAPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKTKNPEIVI
CQYMDDLYVASDLEKEQHRAKIEELRQHLLSWGLTTPDKKYQKDPPLLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREI

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005