<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35085 57393 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NVP 13
2 None 13
3 AZT+3TC+IDV 52

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     A98G P4S, V35T, E36D, K122E, I135V, T139TA, A158AS, S162A, K173T, Q174K, D177E, T200A, I202V, Q207E, R211K, F214L, P243PT, V245Q, A272P, K275KR, Q278H, T286A, E291D, I293V, S322T D113DE
>57393| codons 1-324
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGEAYFSVPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSPSIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQTIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGAKALTDVVPLTEEAE
LELAENREILKEPVHGVYYDPTKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005