<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL35085 57393 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NVP 13
2 None 13
3 AZT+3TC+IDV 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V L89V I13AV, K14R, K20I, M36I, R41K, I66F, H69K, A71AT  
>57393| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFIKVRQYD
QILIEFCGKKTIGTVLVGPTPVNVIGRNVLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005