<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34988 57183 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 EFV+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101E, G190S   V21VI, K32R, V35T, T39A, E40D, V60I, W88C, D123E, I132IV, I135V, E138Q, S162A, K173T, Q174K, D177E, T200A, Q207E, R211RK, V245Q, E248N, T286A, V292I, I293V, E297A  
>57183| codons 1-323
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIRALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTVPSVNNQTPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
YQYVDDLYVSSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6WR, I13V, K20I, E35D, M36I, R41K, I64M, H69K, K70R, L89M I3IS
>57183| codons 1-99
PQSTLRQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005