<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL8758 56741 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+SQV 156
2 D4T+DDI+IDV+RTV 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82T, L90M F53L I13V, K14R, K20I, E35D, M36I, R41K, Q61H, H69K, A71V, L89I  
>56741| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIMGIGGLVKVRQYD
HILIEICGKKVIGTVLVGPTPTNIIGRNIMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005