<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34392 55893 Portugal 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 56
2 D4T+DDI+EFV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E V75A K101E, Y181C, G190A A98G V35T, I135R, S162A, K173IT, Q174K, D177E, I178M, T200A, Q207EG, R211K, H221Y, L228R, V245Q, T286A, E291D, V292T, I293V, P294A, S322T K73Q, Y318T
>55893| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTEWRQLADFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
CQYMDDLYVASDLEIGQHRAKIEELREHLLKWGFTTPDKKYQKEPPFRWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDTVALTEEAE
LELAENREILKEPVHGVTYDPTKD

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005