<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL34134 55359 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 None 52
3 AZT+3TC+NVP 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y   K103N K238T V35K, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207EG, R211S, V245Q, E248D, D250E, A272AP, I274IV, T286A, E291D, V292I, I293V, E297A  
>55359| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLSWGFYTPDKKHQKEPPFLWMGYELHPDTWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGVKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPVHGVYY

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005