<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_SK2 SP_SK2 Spain 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ AZT+ 3TC 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W T215S     V60I, R83K, A98S, I135V, E138A I94V
>SP_SK2| codons 45-215
GKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGVPHPSGLKKKK
SVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQSSM
TKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFS

References
Author Title Citation
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005