<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_M2773 SP_M2773 Spain 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NVP+ NFV 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215S K103N   V35T, E36D, T39L, I135V, I142V, S162A, K173A, Q174K, D177E, I178M, T200A, Q207E  
>SP_M2773| codons 23-217
QWPLTEEKIKALTDICLEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNK
RTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGV
RYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEMVIYQYMDDLYVGSDLEIGQHRAKI
EELREHLLRWGFSTP

References
Author Title Citation
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005