<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_M2388 SP_M2388 Spain 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ DDI+ AZT 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, K43R, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, D177E, T200A, Q207K, R211S  
>SP_M2388| codons 29-217
EKIKALTEICTEMEREGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRKH
LLSWGFTTP

References
Author Title Citation
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005