<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP5 SP_LP5 Spain 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NNRTI+ NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   V35T, E36A, T39K, K43E, K122E, D123N, I142V, S162H, K173S, D177E, V179I, T200A, Q207A, H208Y, R211S  
>SP_LP5| codons 29-231
EKIKALTAICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGVRYQYNV
LPQGWKGSPAIFQHSMTKILEPFRSQNPEIIIYQYMDDLYVGSDLEIGQHRAKIEELRAY
LLSWGFTTPDKKHQKEPPFLWMG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, E35D, M36I, R41K, L63V, H69K, L89M  
>SP_LP5| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003