<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP38 SP_LP38 Spain 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NNRTI+ NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K20I, M36I, N37S, R41K, H69K, L89M  
>SP_LP38| codons 1-99
PQITLWQRPLVTAKIGGQLIEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005