<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP33 SP_LP33 Spain 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NNRTI+ NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R K219N K103N, Y181C, G190A   S162C  
>SP_LP33| codons 33-230
ALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQCSMTKILEPFRKQNPDIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLRW
GFTTPDNKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63S, V77I  
>SP_LP33| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003