<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1277 CA3066 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 74
2 D4T 30
3 DDI 68
4 AZT+ DDC 48
5 None 60
6 3TC+ AZT 7
7 3TC+ AZT+ IDV 8
8 3TC+ AZT+ NFV 30

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     V60I, K103R, K104N, S162A, T200A, Q207E, F214L, A272P, K277R, A288S  
>CA3066| codons 1-292
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L23LI N37NT, R41RK, L63P, T74TA, V82I, I93L  
>CA3067| codons 1-99
PQITLWQRPLVTIKIGGQLKEAILDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGAVLVGPTPINIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005