<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
D9699 D9699 Japan 2014 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC|ABC|LPV NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V32I, S39C, I84M, L101I, S119P, G193R, V201I, A205S, T206S  
>D9699| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVIAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGRYSAGERIIDIISSDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hachiya, A Natural polymorphism S119R of HIV-1 integrase enhances primary INSTI resistance. Antiviral Res, 2015