<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
N746 N746 Japan 2013 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ATV|FTC|RTV|TDF NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    R20K, V31I, I84M, S119T, T124A, V201I, I203M, T206S P233PL
>N746| codons 1-288
FLDGIDKAQEEHEKYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYMEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGTN
FTSATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDMIASDIQTKELQKQITKIQNFRVYYRDSRDLLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hachiya, A Natural polymorphism S119R of HIV-1 integrase enhances primary INSTI resistance. Antiviral Res, 2015