<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP25 SP_LP25 Spain 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NNRTI+ NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19Q, N37S, L63P, I64L  
>SP_LP25| codons 1-99
PQITLWQRPLVTIKIGGQQKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       S68G, K122E, D123N, I135V, S162A, K173A, Q174K, D177E, I178M, E203K, Q207E K223N
>SP_LP25| codons 33-231
ALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQG
WKGSPAIFQASMTKILEPFRAKNPEMVIYQYVDDLYVGSDLEIGQHRTKIKELREHLWRW
GFYTPDKKHQNEPPFLWMG

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003