<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP24 SP_LP24 Spain 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, L19P, K20I, E35D, M36I, R41K, H69K, L89M  
>SP_LP24| codons 1-99
PQITLWQRPVVTVKIGGQPIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, D121H, K122E, D123S, I142V, S162H, K173S, Q174R, D177E, V179I, Q207A, R211K, F214L  
>SP_LP24| codons 29-231
EKIKALTEICAEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGVRYQYNV
LPQGWKGSPAIFQHSMTKILEPFRSRNPEIIIYQYMDDLYVGSDLEIGQHRTKIEELRAH
LLKWGLTTPDKKHQKEPPFLWMG

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. J Clin Virol, 2004