<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP22 SP_LP22 Spain 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+ NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36D, T69N, V106I, K122E, D123S, I135T, I142V, S162Y, K173S, D177E, V179I, Q207A, R211K A33H, L34S, K220R
>SP_LP22| codons 32-220
KHSTDICTEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQ
LGIPHPAGLKKKKSITVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGVRYQYNVLPQ
GWKGSPAIFQYSMTKILEPFRSQNPEIIIYQYVDDLYVGSDLEIGQHRTKIEELRAHLLK
WGFTTPDKR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I3V, L10I, T12P, I13V, I15V, K20I, E35N, M36I, R41K, I64M, H69K, L89M  
>SP_LP22| codons 1-99
PQVTLWQRPIVPVKVGGQLIEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QILMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005