<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP21 SP_LP21 Spain 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35K, E36D, V60I, S68G, I135V, S162A, K173T, Q174K, D177E, T200A, E203D, Q207E, R211K  
>SP_LP21| codons 35-224
KDICTEMEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGI
PHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWK
GSPAIFQASMTKILEPFRTKNPEIVIYQYMDDLYVGSDLEIGQHRAKIDELREHLLKWGF
TTPDKKHQKE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19P, K20I, M36I, R41K, I64M, H69K, K70R, L89M  
>SP_LP21| codons 16-99
GGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQILMEICGKRAIGTV
LVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005