Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SP_LP16 | SP_LP16 | Spain | 1999 | HIV1 | CRF02_AG | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | None | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| T12P, I13V, K14G, K20I, M36I, R41K, K43R, H69K, K70R, L89M |
| >SP_LP16| codons 9-99 PLVPVGIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYDQILIEICG KRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Holguin, A | HIV-positive immigrants in the Canary Islands, Spain: implications for public health in Europe. | HIV Clin Trials, 2003 |
| Holguin, A | Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. | J Clin Virol, 2004 |
| Holguin, A | Heterogeneous nature of HIV-1 recombinants spreading in Spain. | J Med Virol, 2005 |