<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP16 SP_LP16 Spain 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, K14G, K20I, M36I, R41K, K43R, H69K, K70R, L89M  
>SP_LP16| codons 9-99
PLVPVGIGGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYDQILIEICG
KRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. J Clin Virol, 2004
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005