<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_LP15 SP_LP15 Spain 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NNRTI+ NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G16E, K20I, M36I, R41K, K43R, H69K, K70R, L89M I13S, I15N
>SP_LP15| codons 1-99
PQITLWQRPLVTSRNEGQLIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K64R, S68R, K122E, I135V, A158S, S162A, K173A, Q174N, D177E, T200A, Q207E, R211K  
>SP_LP15| codons 37-225
ICTEMEKEGKISKIGPENPYNTPIFAIRKKDRTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGS
PSIFQASMTKILEPFRANNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTT
PDKKHQKEP

References
Author Title Citation
Holguin, A HIV-positive immigrants in the Canary Islands, Spain: Implications for public health in Europe. HIV Clin Trials, 2003
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005