<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_22158 SP_22158 Spain 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17E, K20I, M36I, L63H, H69K, K70R, L89M  
>SP_22158| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, E36D, S68G, K122P, D123E, I135T, I142V, S162A, D177E, I178V, T200A, Q207E  
>SP_22158| codons 33-226
ALIDICTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDPEFRKYTAFTIPSTNNETPGVRYQYNVLPQG
WKGSPAIFQASMTKILEPFRKQNPEVVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLRW
GFTTPDKKHQKEPP

References
Author Title Citation
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005