<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SP_19804 SP_19804 Spain 2000 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       V35T, K49R, V60I, K122E, D123N, E138A, S162A, K173T, Q174K, I178V, T200A, Q207K, R211T, E224N  
>SP_19804| codons 19-225
PKVKQWPLTEEKIKALTEICTELEKEGKISRIGPENPYNTPIFAIKKKDSTKWRKLVDFR
ELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNA
TPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPDVVIYQYMDDLYVGSDLEIGQH
RAKIEELRKHLLTWGFTTPDKKHQKNP

References
Author Title Citation
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005