<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VI-279 VI-279 Vietnam 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  V151I K14R, A21T, V31I, S39N, L45Q, I72V, L101V, T112V, T124A, T125A, G134N, I135V, K136R, S153A, V165I, D167E, V201I, S230N, L234I G277D, S283G
>VI-279| codons 1-288
FLDGIDKAQEEHERYHSNWRTMASDFNLPPIVAKEIVANCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFVLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVRQEFGIPYNPQSQGVIEAMNKELKKIIGQIREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDNRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMADDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, G16A, E35D, M36I, N37D, R41K, L63P, I64V, H69K, K70R, L89M, I93L  
>VI-279| codons 1-99
PQITLWQRPLVTVKVAGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, V111I, K122E, D123S, S162H, K173I, Q174K, D177E, Q207S, R211S, K238R, V245E, A272P, T286A, V292I, I293V, E312NT, G335D, A355S, M357K, G359S, K366R, A371V, K390R, K395R, A400T, T403M, E432D, N447S, D471E, Q480H, L491S, K512R, L517V, S519N, Q524E, K527R, E529K, A534S, A554N I326AV
>VI-279| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRSHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEIQKQGQDQWTYQIYQEPFKNLKTGKYSRKRSA
HTNDVRQLTEVVQKIATESIVIWGKTPKFRLPIQRETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESEVVNQIIEELIRKKKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

References
Author Title Citation
Van Tran, G A strong association of human leukocyte antigen-associated Pol and Gag mutations with clinical parameters in HIV-1 subtype A/E infection. AIDS, 2016