<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BE65 BE65 Belgium 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K22R, E28EA, V35T, T39E, E40D, K49KR, I50IV, V118I, K122E, D123NS, I135T, K173L, Q174K, D177E, Q207A, R211S, F214L, V245X, E248ED, D250DE, S251SN, K281R, T286A, E291D, V292I, I293V, P294T, E312DN, D320DE, D324E  
>BE65| codons 1-330
PISPIETVPVKLKPGMDGPKVRQWPLTAEKIKALTEICEDMEKEGKISRVGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIXLPDKENWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYEPSKELIAEIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, R41K, H69K, L89M  
>BE65| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Snoeck, J Rising prevalence of HIV-1 non-B subtypes in Belgium: 1983-2001. JAIDS, 2004
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005