<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1271 CA3051 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 D4T 100
4 3TC+AZT 35
5 3TC+AZT+IDV 22
6 3TC+D4T+IDV 13
7 3TC+D4T+IDV+NVP 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V G73C E35D, N37E, R41K, L63P, K70T, V77I, I93L  
>CA3051| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTILEDMELPGKWKPKMVGGIGGFIKVRQYD
QIPIEICGHTAICTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219N G190A   K20R, T39A, E44D, V118I, K122E, I135T, D177E, E203K, H208Y, R211D, L283I, R284K, I293V  
>CA3050| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVASDLEIGQHRTKIKELRQYLWDWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIKGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005