<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt36 pt36-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 AZT+ DDC+ IDV NA
3 3TC+ AZT+ IDV NA
4 D4T+ DDI+ RTV+ SQV NA
5 3TC+ D4T+ RTV+ SQV NA
6 AZT+ DDI+ EFV+ NFV NA
7 AZT+ DDI NA
8 ABC+ DDI+ RTV+ SQV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, L74I, T215F D67H, K219Q G190A   K20R, A62AP, T69N, D123E, I142IT, S162C, E169D, I178L, H208Y, R211K, D218E F160FS
>pt36-t0| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FPIKKKHSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAISQCSMTKILDPFRKQNPDLVI
YQYMDDLYVASDLEIGQHRTKIEELRQYLLKWGFFTPEQKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, I62V, L63P, H69K, V77I  
>pt36-t0| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGKKAIGTVLIGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005