<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt35 pt35-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 3TC+ AZT NA
4 3TC+ AZT+ SQV NA
5 D4T+ DDI+ SQV NA
6 D4T+ DDI+ IDV NA
7 D4T+ DDI+ NFV NA
8 D4T+ DDI+ EFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, T12S, L19T, K20KI, I62V, L63S, A71T, V77I  
>pt35-t0| codons 1-99
PQITLWQRPIVSIKIGGQTIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVSIEICGHKTIGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   L100I, K103N   K20R, K43Q, V118I, K122E, D123DN, I135T, I202V, R211RK, L228R  
>pt35-t0| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLWKWGFYTPDKKHQKEPPFRWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005