<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt19 pt19-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 D4T+ DDI NA
3 D4T+ DDI+ SQV NA
4 D4T+ DDC+ NFV NA
5 D4T+ DDC+ DLV NA
6 3TC+ D4T+ IDV NA
7 D4T+ DDI+ IDV NA
8 D4T+ DDI+ IDV+ RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L10F, L33I, G73S, N83D A22V, E35G, M36I, R41K, I62V, L63P, A71V, I72L, I85V  
>pt19-t0| codons 1-99
PQITLWQRPFVTIKIGGQLKEVLLDTGADDTVIEGINLPGKWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVLSTVLVGPTPVDVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, L210W, T215Y K219R K103N, Y181YC   K20R, V35I, K43Q, E44D, V111I, V118I, D123E, I178F, G196E, H208Y, R211K, K223Q  
>pt19-t0| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDFVI
CQYMDDLYVGSDLEIEQHRTKIEELRQYLWKWGFYTPDRKHQQEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005