<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt18 pt18-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 AZT+ DDC+ SQV NA
4 3TC+ AZT+ SQV NA
5 3TC+ D4T+ IDV NA
6 D4T+ DDI+ RTV+ SQV NA
7 D4T+ DDI+ EFV+ NFV NA
8 3TC+ AZT+ IDV+ RTV NA
9 3TC+ AZT+ EFV+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M Q58E, G73T L10I, K20R, E35D, M36I, N37D, I62V, L63P, A71V P79R
>pt18-t1| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVREYD
QVPIEICGHKVITTVLVGRTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y K219R Y188L   K43Q, E44D, V106I, V118I, K122P, D123E, S162C, D177E, I178L, T200K, Q207E, H208Y, R211K, K223Q, L228H P133PL
>pt18-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DPEFRKYTAFTILSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPELVI
YQYMDDLLVGSDLEIGQHRKKIEELREYLWKWGFYTPDRKHQQEPPFHWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005