<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt33 pt33-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T NA
2 AZT+ DDI NA
3 3TC+ AZT+ SQV NA
4 3TC+ D4T+ SQV NA
5 D4T+ EFV+ IDV NA
6 3TC+ D4T+ IDV NA
7 D4T+ IDV+ NVP NA
8 D4T+ DDI+ IDV NA
9 D4T+ DDI+ RTV+ SQV NA
10 3TC+ ABC+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33I, G73S L10I, K20KR, E34EK, E35D, M36I, N37D, K45R, I62V, L63P, A71V, I72IL  
>pt33-t1| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVIKDIDLPGRWKPRMIGGIGGFVKVRQYD
QVPIEICGHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103KN   P4S, K20R, T39A, S48E, V60I, V118I, K122P, D123E, I135V, D177E, Q207E, R211K K220I
>pt33-t1| codons 1-230
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKIEKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DPEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKIHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005