<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1270 CA3049 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 3TC 52
4 D4T 36
5 AZT+SQV 52
6 NVP 52
7 AZT+IDV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S K20I, N37D, L63P, A71V V11VD
>CA3049| codons 1-99
PQITLWQRPLDTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y       W88S, K166I, R211K, K277R, T286A, E291D, A299X  
>CA3048| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTIILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVIPLTEEXE
LEL

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005