<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt17 pt17-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 DDC NA
4 AZT+ DDC NA
5 AZT+ DDC+ SQV NA
6 3TC+ D4T+ RTV NA
7 DDI+ EFV+ NFV NA
8 D4T+ DDI+ LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, L210W, T215Y D67E K103N, Y181C, G190A K101N V35T, T39A, E44D, S68G, K82R, V118I, K122E, D123E, I135T, I142V, D177E, I178L, G196E, E204N, R211N  
>pt17-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLMDFRELNRRTQDFWEVQLGIPHPAGLNKNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
CQYMDDLYVASDLEIEQHRTKIENLRQHLWNWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A, L90M   T4S, L10I, L19V, K20R, M36I, N37D, I62V, L63P, I64V, H69I  
>pt17-t1| codons 1-99
PQISLWQRPIVTIKIGGQVREALLDTGADDTVLEEIDLPGRWKPKMIVGIGGFSKVRQYD
QVPVEICGIKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005