<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt17 pt17-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 DDC NA
4 AZT+ DDC NA
5 AZT+ DDC+ SQV NA
6 3TC+ D4T+ RTV NA
7 DDI+ EFV+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M   L10I, K20R, M36I, N37D, K45R, I62V, L63P, I64V, H69N  
>pt17-t0| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEIDLPGRWKPRMIGGIGGFIKVRQYD
QVPVEICGNKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67E, V75M K103N, Y181YC, G190A   V35T, T39A, E44D, S68G, K122E, D123E, I135T, I142M, D177E, I178L, G196E, E204N, R211N  
>pt17-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSTNNETPGMRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
CQYMDDLYVASDLEIEQHRTKIENLRQHLWNWGFYTPDKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005